| Sequence |
MGSSHHHHHHSSGLVPRGSHM A V E SRVTQ E E IKK E P E KPIDR E KTCPLLLRVFTTNNGRHHRMD E FSRGNVPSS E LQIYTWMD A TLK E LTSLVK E VYP E A RKKGTHFNF A IVFTDVKRPGYRVK E IGSTMSGRKGTDDSMTLQSQKFQIGDYLDI A ITPPNR A PPPSGRMRPY. Introduction: SAP18 is a component of the histone deacetylase complex which has a significant role in the regulation of eukaryotic gene expression. SAP18 directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression once bound to the promoter. SAP18 plays an important part in gene-specific recruitment of the HDAC complex by a number of transcription factors including Gli, GAGA, and Bicoid. Histone acetylation is significant in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation is catalyzed by multisubunit complexes. SAP18 is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. SAP18 is a component of a splicing-dependent multiprotein EJC (exon junction
|