Active mouse MCP2 full length protein

• Supplier: Abcam
• Catalog: ab192109
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: The ED 50 was determined by the dose-dependent chemo-attraction human PBMC using a range of 10-100 ng/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P80075
• Gene: CCL8
• Residue: 20 to 97
• Sequence: EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQG MSLCVDPTQKWVSEYMEILDQKSQILQP