Active mouse MCP2 protein fragment

• Supplier: Abcam
• Catalog: ab202815
• Category: Protein
• Prices: $359.00
• Sizes: 5 µg
• Applications: SDS-PAGE FA HPLC
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: E. coli
• Purity: > 97 % by SDS-PAGE. > 97 % by HPLC.
• Bioactivity: ab202815 is fully biologically active when compared to standard. Determined by its ability to chemoattract Human peripheral blood monocytes using a concentration range of 10.0-100.0 ng/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P80075
• Gene: CCL8
• Residue: 24 to 97
• Sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLC VDPTQKWVSEYMEILDQKSQILQP