Active mouse PD1 protein fragment
| Name | Active mouse PD1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab180051 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Bioactivity was measured by binding ability in a functional ELISA. Immobilized Recombinant Mouse PD1 /PDCD1 Protein (ab180051) at 5 μg/ml (100 μl/well) can bind Recombinant Mouse PD-L1 /CD274 /B7-H1 protein with C-Fc Tag with a linear range of 0.2-2 μg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q15116 |
| Gene | PDCD1 |
| Residue | 21 to 167 |
| Sequence | SGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRL SPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGI YLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of PD1 in reducing conditions. Gel stained overnight with Coomassie Blue. Protein migrates as 25 - 45 kDa due to different glycosylation.