Active mouse TNF alpha full length protein
| Name | Active mouse TNF alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab157351 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | DDDDK tag N-Terminus |
| Purity | >90% by SDS-PAGE. |
| Bioactivity | Binds to Human, mouse and rat TNF-R1 and less efficiently to TNF-R2. In the presence of cross-linking enhancer, TNF alpha shows a significantly higher affinity for TNF-R2 than for TNF-R1, mimicking the characteristics of membrane-bound TNF alpha. Exerts its biological activity in a concentration range of 0.5-1ng/ml (WEHI 164 cells). |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P01375 |
| Gene | TNF |
| Residue | 77 to 235 |
| Sequence | TLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQ LVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVK SPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESG QVYFGVIAL |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab157351 (1µg).