Recombinant Human ASCL1

Name Recombinant Human ASCL1
Supplier Creative Biomart
Catalog ASCL1-28522TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P50553
Gene ASCL1
Sequence GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Description Recombinant fragment corresponding to amino acids 137-236 of Human MASH1/Achaete-scute homolog 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop