Recombinant Human BARD1

Name Recombinant Human BARD1
Supplier Creative Biomart
Catalog BARD1-26645TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q99728
Gene BARD1
Sequence RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK
Description Recombinant fragment, corresponding to amino acids 658-757 of Human BARD1, with an N-terminal proprietary tag, predicted MWt 36.63 kDa
Supplier Page Shop