| Name | Recombinant Human CD55, His-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | CD55-26634TH |
| Category | Protein |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >90% by SDS-PAGE |
| SwissProt/Accession | P08174 |
| Gene | CD55 |
| Sequence | LPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNR |
| Description | Recombinant fragment: LPPDVPNAQP ALEGRTSFPE DTVITYKCEE SFVKIPGEKD SVICLKGSQW SDIEEFCNR, corresponding to amino acids 38-96 of Human CD55 fused to a His tag at N-terminal end, 11kDa. |
| Supplier Page | Shop |