Recombinant Human CPT1A

Name Recombinant Human CPT1A
Supplier Creative Biomart
Catalog CPT1A-26794TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P50416
Gene CPT1A
Sequence VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
Description Recombinant fragment corresponding to amino acids 461-550 of Human CPT1A with an N terminal proprietary tag; Predicted MWt 35.53 kDa.
Supplier Page Shop