Recombinant Human CYP1B1

Name Recombinant Human CYP1B1
Supplier Creative Biomart
Catalog CYP1B1-28190TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q16678
Gene CYP1B1
Sequence NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC
Description Recombinant fragment corresponding to amino acids 453-542 of Human CYP1B1 with an N terminal proprietary tag; Predicted MWt 35.64 kDa.
Supplier Page Shop