Active rat CX3CL1 protein fragment

Name Active rat CX3CL1 protein fragment
Supplier Abcam
Catalog ab201406
Category Protein
Prices $107.00
Sizes 5 µg
Applications FA HPLC SDS-PAGE
Species Reactivities Rat
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE . >95% by HPLC analysis.
Bioactivity Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using Human monocytes is in a concentration of 5.0-10 ng/ml.
SwissProt/Accession P78423
Gene CX3CL1
Residue 25 to 100
Sequence QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFC ADPKEKWVQDAMKHLDHQTAALTRNG
Supplier Page Shop