| Name | Recombinant Human ELK4 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | ELK4-28290TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P28324 |
| Gene | ELK4 |
| Sequence | KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA |
| Description | Recombinant fragment corresponding to amino acids 118-206 of Human ELK4 with an N terminal proprietary tag; predicted mwt: 35.42 kDa inclusive of tag. |
| Supplier Page | Shop |