Recombinant Human FBN1

Name Recombinant Human FBN1
Supplier Creative Biomart
Catalog FBN1-28892TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P35555
Gene FBN1
Sequence SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Description Recombinant fragment corresponding to amino acids 2772-2871 of Human Fibrillin 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop