Active rat IGF1 full length protein

• Supplier: Abcam
• Catalog: ab191786
• Category: Protein
• Prices: $192.00
• Sizes: 50 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Rat
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: The ED 50 was determined by a cell proliferation assay using FDC-P1 cells is ≤ 1.0 ng/mL, corresponding to a specific activity of ≥ 1.0 x 10 6 units/mg.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P05019
• Gene: IGF1
• Residue: 49 to 118
• Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPTKSA