| Name | Active rat IL21 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200267 |
| Category | Protein |
| Prices | $107.00 |
| Sizes | 2 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 96 % by SDS-PAGE. ab200267 is > 96 % pure as assessed by SDS-PAGE and HPLC analyses. |
| Bioactivity | The ED 50 as determined by a cell proliferation assay using human N1186 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10 4 IU/mg. |
| SwissProt/Accession | Q9HBE4 |
| Gene | IL21 |
| Residue | 18 to 146 |
| Sequence | HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHE AFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPS CDLYEKKTPKEFLERLKWLLQKMIHQHLS |
| Supplier Page | Shop |