| Name | Recombinant Human IFI16 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | IFI16-26947TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | Q16666 |
| Gene | IFI16 |
| Sequence | FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF |
| Description | Recombinant fragment corresponding to amino acids 630-729 of Human IFI16, with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag |
| Supplier Page | Shop |