Active rat ITK protein fragment
| Name | Active rat ITK protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab196125 |
| Category | Protein |
| Prices | $891.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | Baculovirus infected sf9 cells |
| Tag/Conjugation | GST tag N-Terminus |
| Purity | >= 58 % by SDS-PAGE. |
| Bioactivity | Specific Activity: 1.0 pmol/min/μg |
| SwissProt/Accession | Q08881 |
| Gene | ITK |
| Residue | 352 to 620 |
| Sequence | PVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQE GAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSD YLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQV IKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFG VLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASPHVYQVMNHCW KEKPEDRPPFSRLLSQLAE |
| Supplier Page | Shop |
Product images
10% SDS-PAGE analysis of ab196125 with Coomassie staining. Lane 1: 20 µg Active rat ITK protein fragment (ab196125) Lane 2: Protein marker
Enzyme reaction was conducted at 30°C for 1 hour with 2 μM Tyr peptide in 50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgCl 2 , 1 mM EGTA. After the 1 hour incubation, diluted development reagent was added. Percentage phosphorylation was calculated based on the emission ratio of 445/520 nm after excitation.