Recombinant Human ITGA7

Name Recombinant Human ITGA7
Supplier Creative Biomart
Catalog ITGA7-28842TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q13683
Gene ITGA7
Sequence SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ
Description Recombinant fragment corresponding to amino acids 478-577 of Human ITGA7 with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag.
Supplier Page Shop