| Name | Recombinant Human JARID2 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | JARID2-27632TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | Q92833 |
| Gene | JARID2 |
| Sequence | LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP |
| Description | Recombinant fragment corresponding to amino acids 1130-1229 of Human Jarid2 with a proprietary tag at N-terminal predicted MWt 37 kDa |
| Supplier Page | Shop |