Recombinant Human KCNA1

Name Recombinant Human KCNA1
Supplier Creative Biomart
Catalog KCNA1-29199TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q09470
Gene KCNA1
Sequence NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKYEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV
Description Recombinant fragment corresponding to amino acids 410-495 of Human Kv1.1 potassium channel with an N terminal proprietary tag; Predicted MWt 35.09 kDa.
Supplier Page Shop