Name | Recombinant Human KCNA1 |
---|---|
Supplier | Creative Biomart |
Catalog | KCNA1-29199TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q09470 |
Gene | KCNA1 |
Sequence | NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKYEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV |
Description | Recombinant fragment corresponding to amino acids 410-495 of Human Kv1.1 potassium channel with an N terminal proprietary tag; Predicted MWt 35.09 kDa. |
Supplier Page | Shop |