Recombinant Human KCNJ11

Name Recombinant Human KCNJ11
Supplier Creative Biomart
Catalog KCNJ11-29900TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q14654
Gene KCNJ11
Sequence RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
Description Recombinant fragment corresponding to amino acids 301-390 of Human Kir6.2 with an N terminal proprietary tag; Predicted MWt 35.53 kDa inclusive of tag.
Supplier Page Shop