Name | Recombinant Human KCNJ11 |
---|---|
Supplier | Creative Biomart |
Catalog | KCNJ11-29900TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q14654 |
Gene | KCNJ11 |
Sequence | RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS |
Description | Recombinant fragment corresponding to amino acids 301-390 of Human Kir6.2 with an N terminal proprietary tag; Predicted MWt 35.53 kDa inclusive of tag. |
Supplier Page | Shop |