Active human Activin A Receptor Type IB protein fragment
| Name | Active human Activin A Receptor Type IB protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab182676 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 200 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 92 % by SDS-PAGE. |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human TDGF1 at 2 μg/ml (100 μl/well) can bind ab182676 with a linear range of 0.032 - 2 μg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P36896 |
| Gene | ACVR1B |
| Residue | 24 to 126 |
| Sequence | SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKV ELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWG PVE |
| Supplier Page | Shop |
Product images
The purity of ab182676 was determined by DTT-reduced (+) and non-reduced (-) SDS-PAGE and staining overnight with Coomassie Blue.