| Name | Active rat VEGFC full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab52146 |
| Category | Protein |
| Prices | $257.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | Insect cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | > 90 % by SDS-PAGE. Purity >90% by SDS-PAGE and visualised by silver stain. Product is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGFC by a Ser residue. |
| Bioactivity | This product is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT -4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR. |
| SwissProt/Accession | P49767 |
| Gene | VEGFC |
| Residue | 101 to 221 |
| Sequence | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH |
| Supplier Page | Shop |