Recombinant Human M6PR, His-tagged

• Supplier: Creative Biomart
• Catalog: M6PR-29239TH
• Category: Protein
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• SwissProt/Accession: P20645
• Gene: M6PR
• Sequence: MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF
• Description: Recombinant fragment: MFPFYSCWRT GLLLLLLAVA VRESWQTEEK TCDLVGEKGK ESEKELALVK RLKPLFNKSF, corresponding to N terminal amino acids 1-60 of Human Mannose 6 Phosphate Receptor fused to a His tag, 12kDa.