Name | Recombinant Human MSR1 |
---|---|
Supplier | Creative Biomart |
Catalog | MSR1-30164TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P21757 |
Gene | MSR1 |
Sequence | MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVY |
Description | Recombinant fragment corresponding to amino acids 121-220 of Human Macrophage Scavenger Receptor I with a proprietary tag; Predicted MWt 36.63 kDa including tag. |
Supplier Page | Shop |