Recombinant Human MSR1

Name Recombinant Human MSR1
Supplier Creative Biomart
Catalog MSR1-30164TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P21757
Gene MSR1
Sequence MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVY
Description Recombinant fragment corresponding to amino acids 121-220 of Human Macrophage Scavenger Receptor I with a proprietary tag; Predicted MWt 36.63 kDa including tag.
Supplier Page Shop