Recombinant Human OCA2

Name Recombinant Human OCA2
Supplier Creative Biomart
Catalog OCA2-30532TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q04671
Gene OCA2
Sequence GKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV
Description Recombinant fragment of Human P protein with a N terminal proprietary tag; Predicted MWt 36.63 kDa including the tag.
Supplier Page Shop