Name | Recombinant Human OPRK1 |
---|---|
Supplier | Creative Biomart |
Catalog | OPRK1-28446TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P41145 |
Gene | OPRK1 |
Sequence | MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI |
Description | Recombinant fragment, corresponding to amino acids 1-58 of Human Kappa Opioid Receptor, with an N-terminal proprietary tag, 32.01 kDa inclusive of tag |
Supplier Page | Shop |