Recombinant Human OPRK1

Name Recombinant Human OPRK1
Supplier Creative Biomart
Catalog OPRK1-28446TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P41145
Gene OPRK1
Sequence MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI
Description Recombinant fragment, corresponding to amino acids 1-58 of Human Kappa Opioid Receptor, with an N-terminal proprietary tag, 32.01 kDa inclusive of tag
Supplier Page Shop