Recombinant Human PDE2A

Name Recombinant Human PDE2A
Supplier Creative Biomart
Catalog PDE2A-29979TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O00408
Gene PDE2A
Sequence REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
Description Recombinant fragment of Human PDE2A (amino acids 850-940) with a N terminal proprietary tag; Predicted MWt 35.64 kDa including the tag.
Supplier Page Shop