Active human Activin Receptor Type IIB protein fragment
| Name | Active human Activin Receptor Type IIB protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155714 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 200 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | > 97 % by SDS-PAGE. |
| Bioactivity | Measured by its ability to inhibit Activin induced hemoglobin expression in K562 Human chronic myelogenous leukemia cells. Approximately 0.2-0.5 µg/ml of ab155714 will inhibit 50% of the biological response due to 3 ng/ml of rhActivin A. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q13705 |
| Gene | ACVR2B |
| Residue | 19 to 137 |
| Sequence | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSG TIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPE AGGPEVTYEPPPTAPTLLT |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab155714 stained overnight with Coomassie Blue.