Recombinant Human PLAG1

Name Recombinant Human PLAG1
Supplier Creative Biomart
Catalog PLAG1-31026TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q6DJT9
Gene PLAG1
Sequence ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Description Recombinant fragment corresponding to amino acids 2-99 of Human PLAG1 with a N terminal proprietary tag; predicted MWt 36.41 kDa inclusive of tag; Q6DJT9,
Supplier Page Shop