Name | Recombinant Human PLAG1 |
---|---|
Supplier | Creative Biomart |
Catalog | PLAG1-31026TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q6DJT9 |
Gene | PLAG1 |
Sequence | ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK |
Description | Recombinant fragment corresponding to amino acids 2-99 of Human PLAG1 with a N terminal proprietary tag; predicted MWt 36.41 kDa inclusive of tag; Q6DJT9, |
Supplier Page | Shop |