Recombinant Human PLCG1

Name Recombinant Human PLCG1
Supplier Creative Biomart
Catalog PLCG1-30735TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P19174
Gene PLCG1
Sequence LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Description Recombinant fragment corresponding to amino acids 1192-1291 of Human Phospholipase C gamma 1 with proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop