Name | Recombinant Human PLN |
---|---|
Supplier | Creative Biomart |
Catalog | PLN-30732TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P26678 |
Gene | PLN |
Sequence | MEKVQYLTRSAIRRASTIEMPQQARQKLQN |
Description | Recombinant fragment corresponding to amino acids 1-30 of Human Phospholamban with an N terminal proprietary tag; Predicted MWt 28.93 kDa inclusive of tag. |
Supplier Page | Shop |