Recombinant Human PLN

Name Recombinant Human PLN
Supplier Creative Biomart
Catalog PLN-30732TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P26678
Gene PLN
Sequence MEKVQYLTRSAIRRASTIEMPQQARQKLQN
Description Recombinant fragment corresponding to amino acids 1-30 of Human Phospholamban with an N terminal proprietary tag; Predicted MWt 28.93 kDa inclusive of tag.
Supplier Page Shop