Recombinant Human PSEN2

Name Recombinant Human PSEN2
Supplier Creative Biomart
Catalog PSEN2-28527TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P49810
Gene PSEN2
Sequence MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAK
Description Recombinant fragment corresponding to amino acids 1-86 of Human Presenilin 2 with an N terminal proprietary tag; Predicted MWt 35.09 kDa.
Supplier Page Shop