Recombinant Human RAD18

Name Recombinant Human RAD18
Supplier Creative Biomart
Catalog RAD18-29579TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q9NS91
Gene RAD18
Sequence EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Description Recombinant fragment corresponding to aa 332-430 of human RAD18 with a proprietary tag; 36.52 inclusive of tag;
Supplier Page Shop