Recombinant Human RIPK3

Name Recombinant Human RIPK3
Supplier Creative Biomart
Catalog RIPK3-29985TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q9Y572
Gene RIPK3
Sequence SPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK
Description Recombinant fragment corresponding to amino acids 418-518 of Human RIP3 with a propreitary tag at N-terminal; predicted mwt: 36.74 kDa.
Supplier Page Shop