Recombinant Human RUNX2

Name Recombinant Human RUNX2
Supplier Creative Biomart
Catalog RUNX2-28321TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q13950
Gene RUNX2
Sequence TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS
Description Recombinant fragment corresponding to amino acids 311-450 of Human RUNX2 with a proprietary tag at N-terminal; Predicted MWt 41.03kDa inclusive of tag.
Supplier Page Shop