Recombinant Human SLC4A1

Name Recombinant Human SLC4A1
Supplier Creative Biomart
Catalog SLC4A1-26065TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P02730
Gene SLC4A1
Sequence PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK
Description Recombinant fragment corresponding to amino acids 261-360 of Human Band 3, with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag NP.
Supplier Page Shop