Name | Recombinant Human SLC4A1 |
---|---|
Supplier | Creative Biomart |
Catalog | SLC4A1-26065TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P02730 |
Gene | SLC4A1 |
Sequence | PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK |
Description | Recombinant fragment corresponding to amino acids 261-360 of Human Band 3, with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag NP. |
Supplier Page | Shop |