Recombinant Human SORL1

Name Recombinant Human SORL1
Supplier Creative Biomart
Catalog SORL1-29617TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q92673
Gene SORL1
Sequence SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD
Description Recombinant fragment corresponding to amino acids 82-181 of Human SorLA with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop