Name | Recombinant Human SREBF2 |
---|---|
Supplier | Creative Biomart |
Catalog | SREBF2-31395TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q12772 |
Gene | SREBF2 |
Sequence | QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT |
Description | Recombinant fragment corresponding to amino acids 801-900 of Human SREBP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
Supplier Page | Shop |