Recombinant Human SRSF3

Name Recombinant Human SRSF3
Supplier Creative Biomart
Catalog SRSF3-26855TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P84103
Gene SRSF3
Sequence MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK
Description Recombinant fragment corresponding to amino acids 1-85 of Human SFRS3 with an N terminal proprietary tag; Predicted MWt 34.98 kDa.
Supplier Page Shop