Recombinant Human TRPV3

Name Recombinant Human TRPV3
Supplier Creative Biomart
Catalog TRPV3-28682TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q8NET8
Gene TRPV3
Sequence VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV
Description Recombinant fragment corresponding to amino acids 681-790 of Human TRPV3 with a proprietary tag at N-terminal; Predicted MWt 37.73 kDa.
Supplier Page Shop