Recombinant Human WRN

Name Recombinant Human WRN
Supplier Creative Biomart
Catalog WRN-30699TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q14191
Gene WRN
Sequence NPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Description Recombinant fragment of Human Werners syndrome helicase WRN with a proprietary tag: predicted molecular weight 37.84 kDa.
Supplier Page Shop