Recombinant Human ZIC1

Name Recombinant Human ZIC1
Supplier Creative Biomart
Catalog ZIC1-31656TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q15915
Gene ZIC1
Sequence LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN
Description Recombinant fragment corresponding to amino acids 2-95 of Human Zic1 with a proprietary tag: Predicted MWt 35.97 kDa.
Supplier Page Shop