Recombinant human Egl nine homolog 2

Name Recombinant human Egl nine homolog 2
Supplier Cusabio
Catalog CSB-YP007482HU CSB-BP007482HU CSB-MP007482HU
Category Protein
Species Reactivities Human
Nature Recombinant
Source Yeast or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession Q96KS0
Gene EGLN2
Residue 283-407aa
Sequence MVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Description Partial of the full length of 1-407aa
Supplier Page Shop