Recombinant human Potassium voltage-gated channel subfamily A member 1 protein

Name Recombinant human Potassium voltage-gated channel subfamily A member 1 protein
Supplier Cusabio
Catalog CSB-EP012005HU CSB-BP012005HU CSB-MP012005HU
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession Q09470
Gene KCNA1
Residue 1-154aa
Sequence MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW
Description Partial of the full length of 1-495aa
Supplier Page Shop