Recombinant human Large neutral amino acids transporter small subunit 3

Name Recombinant human Large neutral amino acids transporter small subunit 3
Supplier Cusabio
Catalog CSB-EP133474h CSB-BP133474h CSB-MP133474h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession O75387
Gene SLC43A1
Residue 214-303aa
Sequence TLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCSPT
Description Partial of the full length of 1-559aa
Supplier Page Shop