Recombinant human Ras-related protein Rab-8A protein

Name Recombinant human Ras-related protein Rab-8A protein
Supplier Cusabio
Catalog CSB-EP051744h CSB-BP051744h CSB-MP051744h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 90%
SwissProt/Accession P61006
Gene RAB8A
Residue 3-193aa
Sequence KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP
Description Partial of the full length of 1-204aa
Supplier Page Shop