Recombinant human Biogenesis of lysosome-related organelles complex 1 subunit 1

Name Recombinant human Biogenesis of lysosome-related organelles complex 1 subunit 1
Supplier Cusabio
Catalog CSB-EP004954h CSB-BP004954h CSB-MP004954h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 90%
SwissProt/Accession P78537
Gene BLOC1S1
Residue 1-153aa
Sequence MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
Description Full length
Supplier Page Shop