Recombinant Dog Epididymal secretory protein E1(NPC2)

Name Recombinant Dog Epididymal secretory protein E1(NPC2)
Supplier Cusabio
Catalog CSB-EP634688DO
Category Protein
Species Reactivities Dog
Nature Recombinant
Source Yeast
Tag/Conjugation His-tag
Purity >90% ( SDS-PAGE )
SwissProt/Accession Q28895
Gene NPC2
Residue 22-149aa
Sequence VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG
Description Full length of the Epididymal secretory protein E1 domain
Supplier Page Shop

Product images