Active human B7 DC protein fragment
| Name | Active human B7 DC protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab191980 |
| Category | Protein |
| Prices | $536.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized B7 DC at 1 µg/mL (100 µl/well) can bind PDCD-1 with a linear range of 15 - 500 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9BQ51 |
| Gene | PDCD1LG2 |
| Residue | 20 to 219 |
| Sequence | LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPH RERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKV KASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRT PEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHP |
| Supplier Page | Shop |
Product images
The purity of ab191980 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 35-48 kDa due to glycosylation.